PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G067300.1
Common NamePHAVU_008G067300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 309aa    MW: 34420.5 Da    PI: 8.0737
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G067300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.8e-171462148
                        TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEde+l+ ++k+ Gg+ +W++ +r+ g+ R++k+c++rw +yl
  Phvul.008G067300.1 14 KGPWTAEEDEILASYIKKNGGHgSWRSLPRMAGLLRCGKSCRLRWTNYL 62
                        79*******************9***********99************97 PP

2Myb_DNA-binding50.16.4e-1668113148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++T+eE++l ++++  lG++ W++Ia+ ++ gRt++++k+ w+++l
  Phvul.008G067300.1  68 RGPFTQEEEKLVIQLHGILGNR-WAAIASQLP-GRTDNEIKNLWNTHL 113
                         89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-22565IPR009057Homeodomain-like
PROSITE profilePS5129415.301962IPR017930Myb domain
SuperFamilySSF466893.16E-2811109IPR009057Homeodomain-like
SMARTSM007175.0E-121364IPR001005SANT/Myb domain
PfamPF002491.4E-141462IPR001005SANT/Myb domain
CDDcd001671.15E-81662No hitNo description
PROSITE profilePS5129425.34763117IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.0E-2666118IPR009057Homeodomain-like
SMARTSM007176.3E-1567115IPR001005SANT/Myb domain
PfamPF002499.7E-1568113IPR001005SANT/Myb domain
CDDcd001675.52E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGRTPCCDKK GLKKGPWTAE EDEILASYIK KNGGHGSWRS LPRMAGLLRC GKSCRLRWTN  60
YLRPDIKRGP FTQEEEKLVI QLHGILGNRW AAIASQLPGR TDNEIKNLWN THLKKRLKSM  120
GLDPRTHEPL ASSPSYPFHK AHASVSTRHM AQWESARLEA EARLSNESTR FSQNTTNPNS  180
DAKTTDSDYF LRIWNSEVGE AFRNVVVQHK ADDNKITTTS SCPSPLSAGS SSNKCESIAT  240
NADLASIAQE ITPSNFVKQE LEWRTRGSDS SSSNDMEDSS DTALQLLLDF PINNDMSFLE  300
GNSFMCPL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27121175108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112118LKKRLKS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007139892.10.0hypothetical protein PHAVU_008G067300g
TrEMBLV7B5Y40.0V7B5Y4_PHAVU; Uncharacterized protein
STRINGGLYMA09G39721.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23313280
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-119myb domain protein 17